Type
Monoclonal Antibody
Applications
Western blotting, Immunohistochemistry
Antibodies Applications
Source of Antigen
E. coli
Hosts
Mouse
Isotype
IgG2b
Preparation
The antibody is a mouse monoclonal antibody against recombinant Human Myostatin Propeptide.
Amino Acid Sequence
The immunization antigen (28 kDa) is a protein containing 243 AA of recombinant Human Myostatin Propeptide and 5 extra AA (highlighted).
MGNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRKLN
The amino acid sequence of the recombinant Human Myostatin Propeptide is 100% homologous with the amino acid sequence of the Human Myostatin Propeptide without signaling sequence
Species Reactivity
Human. Not yet tested in other species.
Purification Method
Affinity chromatography on a column with immobilized protein G.
Antibody Content
0.1 mg (determined by BCA method, BSA was used as a standard)
Formulation
The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.
Reconstitution
Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.
Quality Control Test
Indirect ELISA – to determine titer of the antibody
SDS PAGE – to determine purity of the antibody
Note
This product is for research use only.

