Type

Recombinant

Description

CD14 is a cell surface-anchored glycoprotein that is expressed predominantly by monocytes and tissue macrophages. CD14 associates with MD-2 (LY-96) and TLR4 to form a receptor complex, which signals specifically in response to bacterial lipopolysaccharide (LPS) binding. The CD14/MD-2/TLR4 receptor complex signals via MyD88, TIRAP, and TRAF6, and ultimately activates NF-κB. CD14 also exists in a soluble form, designated as sCD14, which is capable of specifically binding LPS in the extracellular space. Recombinant sCD14 is a 331 amino acid glycoprotein comprising the extracellular portion of the CD14 receptor. The calculated molecular weight of Recombinant Human sCD14 is 35.6 kDa.

Amino Acid Sequence

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP

Source

HEK293 cells

Purity

95%

Biological Activity

Determined by the dose dependent activation of NF-κB in a RAW264 cell line based reporter system, using a sCD14 concentration range of 20 ng/μl to 200 ng/μl. The NF-κB activation is enhanced when the assay is done in the presence of 0.25 ng/μl to 1.0 ng/μl bacterial LPS.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C