Type
Recombinant
Description
Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposi’s sarcoma cells, OSM can exert both stimulatory and inhibitory effects on cell proliferation. It stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposi’s sarcoma cells, but inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release (e.g. IL-6, GM-CSF and G-CSF) from endothelial cells, and enhances the expression of low-density lipoprotein receptors in hepatoma cells. OSM shares several structural and functional characteristics with LIF, IL-6, and CNTF. Recombinant Rat Oncostatin M is a 24.4 kDa protein, containing 215 amino acid residues.
Amino Acid Sequence
MKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR
Source
E. coli
Purity
98%
Biological Activity
Assay #1: Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 is 3.0–5.0 µg/ml. Assay #2: Determined by its ability to inhibit Alkaline phosphatase activity of differentiated MC3T3 E1 cells.
Storage/Expiration
–20°C

