Type

Recombinant

Description

MIA is the first discovered member of a family of secreted cytokines termed the MIA/OTOR family. The four known members of this family, MIA, MIA-2, OTOR and TANGO, each contain a Src homology-3 (SH3)-like domain. MIA is an autocrine growth regulatory protein, secreted from chondrocytes and malignant melanoma cells, that promotes melanoma metastasis by binding competitively to fibronectin and laminin in a manner that results in melanoma cell detachment from the extracellular matrix in vivo. Elevated levels of MIA may represent a clinically useful marker for diagnosis of melanoma metastasis, as well as a potential marker for rheumatoid arthritis. Recombinant Human MIA is a 12.2 kDa globular protein containing 108 amino acid residues, including two intramolecular disulfide bonds.

Amino Acid Sequence

MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Source

E. coli

Purity

98%

Biological Activity

The ED₅₀ was determined by the dose-dependant proliferation of the human A375 melanoma cell line. The expected ED₅₀ for this effect is 4–6 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C