Type
Recombinant
Description
IL-13 is an immunoregulatory cytokine produced primarily by activated Th4 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th4 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching, resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and murine IL-13 are cross-species reactive. A variant of IL-13 shows enhanced functional activity compared with the wild type IL-13. PeproTech’s genetic variant, termed Recombinant Human IL-13 Variant, is a mature 115 amino acid protein with a substitution of Q for R at position 112. The calculated molecular weight of Recombinant Human IL-13 Variant is 12.6 kDa.
Amino Acid Sequence
MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Source
E. coli
Purity
98%
Biological Activity
This IL-13 analog shows a two fold increase, relative to wild type IL-13, in bioactivity as measured by the in-vitro dose dependent activation of STAT6 and IL-13 dependent gene induction in transfected A201.1 cells. This analog has also been shown to exhibit increased in vivo activity compared to wild type IL-13, as measured by the induction of airway hyper-responsiveness.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5–1.0 mg/ml. Note: Allow the reconstituted vial to sit at 4oC for at ≥ 2 hours before use. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.
Storage/Expiration
–20°C