Type

Recombinant

Description

IFN-γ is an acid-labile interferon produced by CD4 and CD8 T lymphocytes, as well as activated NK cells. IFN-γ receptors are present in most immune cells, which respond to IFN-γ signaling by increasing the surface expression of class I MHC proteins. This promotes the presentation of antigen to T-helper (CD4+) cells. IFN-γ signaling in antigen-presenting, cells and antigen-recognizing B and T lymphocytes, regulates the antigen-specific phases of the immune response. Additionally, IFN-γ stimulates a number of lymphoid cell functions, including the anti-microbial and anti-tumor responses of macrophages, NK cells, and neutrophils. Human IFN-γ is species-specific and is biologically active only in human and primate cells. Recombinant Murine IFN-γ is a 15.6 kDa protein containing 134 amino acid residues.

Amino Acid Sequence

MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5×10⁶ units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 5–10mM Sodium Phosphate, pH 8.0 to a concentration of 1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C