Type

Recombinant

Description

Flt3-Ligand is a growth factor that regulates proliferation of early hematopoietic cells. Flt3-Ligand binds to cells expressing the tyrosine kinase receptor Flt3. Flt3-Ligand, by itself does not stimulate proliferation of early hematopoietic cells, but synergizes with other CSFs and interleukins to induce growth and differentiation. Unlike SCF, Flt3-Ligand exerts no activity on mast cells. Multiple isoforms of Flt3-Ligand have been identified. The predominant biologically active form is anchored to the cell surface as the extracellular domain of a transmembrane protein (209 a.a.). The membrane-bound isoform can be proteolytically cleaved to generate a biologically active soluble isoform. Recombinant Human Flt3-Ligand is a soluble 17.6 kDa protein consisting of 155 amino acid residues.

Amino Acid Sequence

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Source

E. coli

Purity

98%

Biological Activity

The ED ₅₀ was determined by the dose-dependent stimulation of the proliferation of human AML5 cells is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1×10 ⁶ units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C