Type

Recombinant

Description

CTGF is a member of the CCN family of secreted cysteine-rich regulatory proteins, and is the major mitogenic and chemoattractant protein produced by umbilical vein and vascular endothelial cells. CTGF stimulates the proliferation and differentiation of chondrocytes, induces angiogenesis, promotes cell adhesion of fibroblasts, endothelial and epithelial cells, and binds to IGF, TGF β1 and BMP-4. Cell migration and adhesion are signaled through binding to specific cell surface integrins and to heparin sulfate proteoglycans CTGF (98 a.a.), a lower molecular weight isoform containing the C-terminal portion of the full length CTGF protein, exerts full heparin binding, cell adhesion, and mitogenic CTGF activity. Mature Human CTGF is a 38.0 kDa secreted protein containing 323 amino acid residues. CTGF is comprised of four distinct structural domains (modules), which are identified as IGF binding protein (IGFBP), von Willebrand Factor C (VWFC), thrombospondin type-I (TSP type-I), and C-terminal cysteine knot-like (CTCK) domains. Full length CTGF can be proteolytically cleaved in certain tissues to yield N-terminal truncated isoforms, which, depending on the isoform, contain only the TSP type-I and CTCK domains or contain only the CTCK domain. Recombinant Human CTGF is an 11.0 kDa protein consisting of 97 amino acid residues.

Amino Acid Sequence

GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Source

E. coli

Purity

Greater than 95% by SDS-PAGE gel and HPLC analyses.

Biological Activity

Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED₅₀ for this effect is 1.0–2.0 µg/ml.

Endotoxin

Endotoxin level is < 0.1 ng/µg of protein ( <1EU/µg ).

Formulation

Sterile filtered through a 0.2 micron filter. Lyophilized from 10mM Sodium Acetate, pH 6.0

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (eg, 0.1% BSA) and store at –20 to –80 °C.

Storage/Expiration

 –20°C

Quality Control Test

Verified by UV Spectroscopy and/or SDS-PAGE gel.

Note

This product is intended for research use only.