Type
Recombinant
Description
TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis and apoptosis. As implied by their name, BMPs initiate, promote and regulate the development, growth and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling and maintenance of a variety of other tissues and organs. Increasing evidence indicates that BMP-Smad signaling has a tumor suppressing activity and that BMPs can inhibit tumor growth. BMP-6 is abnormally expressed in breast cancer cell lines; however, its function in promoting breast cancer development is unknown. Recombinant human BMP-6 is a 26.2 kDa homodimeric glycoprotein consisting of two 117 amino acid subunits, which correspond to amino acid residues 397 to 513 of the full-length BMP-6 precursor.
Amino Acid Sequence
VSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Source
HEK293 cells
Purity
95%
Biological Activity
Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 this effect is 0.03–0.06 μg/ml
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.
Storage/Expiration
–20°C
